Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMFG, Human (His)

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMFG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmfg-protein-human-his.html

Purity

96.60

Smiles

SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Molecular Formula

9535 (Gene_ID) O60234 (S2-R142) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC (SHC1) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 24E4]
AM00143PU-N 100 µg

SHC (SHC1) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 24E4]

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL
BNC883257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ncf1 Goat Polyclonal Antibody
AP32141PU-N 100 µg

Ncf1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711616 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF740 conjugate, 0.1mg/mL
BNC741531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene AM CHO
H25031506.100G 100 g

Polystyrene AM CHO

Sign In for Pricing
View Details