Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMFG, Human (His)

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMFG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmfg-protein-human-his.html

Purity

96.60

Smiles

SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Molecular Formula

9535 (Gene_ID) O60234 (S2-R142) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody
TA373804 100 µL

Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human ANG1 (Angiopoietin 1) ELISA Kit
E-UNEL-H0016-01 5x 96 Tests

Uncoated Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human ANG1 (Angiopoietin 1) ELISA Kit
E-UNEL-H0016-02 15x 96 Tests

Uncoated Human ANG1 (Angiopoietin 1) ELISA Kit

Sign In for Pricing
View Details
SREBP2 (SREBF2) Mouse Monoclonal Antibody [Clone ID: OTI4G1]
CF806342 100 µg

SREBP2 (SREBF2) Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD21 Antibody[HB5]
E-AB-F1377H-01 20 Tests

PE/Cyanine7 Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD21 Antibody[HB5]
E-AB-F1377H-02 100 Tests

PE/Cyanine7 Anti-Human CD21 Antibody[HB5]

Sign In for Pricing
View Details