Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMFG, Human (His)

GMFG protein shows predominant expression in the lung, heart, and placenta, emphasizing its important role in these important tissues. As a member of the ADF family of actin-binding proteins within the GMF subfamily, GMFG is involved in cellular processes related to actin dynamics. GMFG Protein, Human (His) is the recombinant human-derived GMFG protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GMFG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmfg-protein-human-his.html

Purity

96.60

Smiles

SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Molecular Formula

9535 (Gene_ID) O60234 (S2-R142) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spink5 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6721302 1.0 µg DNA

Spink5 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
ISLR2 (NM_001130136) Human Tagged Lenti ORF Clone
RC226130L4 10 µg

ISLR2 (NM_001130136) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-MATR3 Antibody Picoband®
A02931-2 100 µg/Vial

Anti-MATR3 Antibody Picoband®

Sign In for Pricing
View Details
Laminin γ-1 rabbit pAb
ES6084-01 50 µL

Laminin γ-1 rabbit pAb

Sign In for Pricing
View Details
Laminin γ-1 rabbit pAb
ES6084-02 100 µL

Laminin γ-1 rabbit pAb

Sign In for Pricing
View Details
Rabbit α2-MG ELISA Kit
ERTAF0011 96 Tests

Rabbit α2-MG ELISA Kit

Sign In for Pricing
View Details