Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Mouse (HEK293)

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-mouse-hek-293.html

Purity

98.0

Smiles

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Molecular Formula

15978 (Gene_ID) P01580 (H23-C155) (Accession)

Molecular Weight

Approximately 12-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+) -Benalaxyl
HY-124894 1 Each

(+) -Benalaxyl

Sign In for Pricing
View Details
DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (AP)
MBS6130966-01 0.1 mL

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (AP)

Sign In for Pricing
View Details
DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (AP)
MBS6130966-02 5x 0.1 mL

DNAI1 (Dynein Intermediate Chain 1, Axonemal, Axonemal Dynein Intermediate Chain 1) (AP)

Sign In for Pricing
View Details
TPR Rabbit Polyclonal Antibody (Carrier-free)
orb3117206 100 µg

TPR Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Mouse Anti-Human IgG4 pFc'-BIOT
9190-08 0.5 mg

Mouse Anti-Human IgG4 pFc'-BIOT

Sign In for Pricing
View Details
5-Isopropyl-2,3-dihydro-1H-inden-1-one
OR91801 1 Each

5-Isopropyl-2,3-dihydro-1H-inden-1-one

Sign In for Pricing
View Details