Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dram2 (NM_001025582) Mouse Tagged ORF Clone Lentiviral Particle
MR201603L4V 200 µL

Dram2 (NM_001025582) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ttc7b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
48708116 3x 1.0 µg

Ttc7b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human LILRB1/CD85j/ILT2 Alexa Fluor 488 Antibody
FAB20171G-100UG 100 µg

Human LILRB1/CD85j/ILT2 Alexa Fluor 488 Antibody

Sign In for Pricing
View Details
Lentiviral human FAXDC2 shRNA (UAS) - Lentiviral human FAXDC2 shRNA (UAS) (100)
GTR15147330 1 Vial

Lentiviral human FAXDC2 shRNA (UAS) - Lentiviral human FAXDC2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Pik3c2g ORF Vector (Rat) (pORF)
ORF073513 1.0 µg DNA

Pik3c2g ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ZNF714 sgRNA CRISPR Lentivector (Human) (Target 1)
K2728202 1.0 µg DNA

ZNF714 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details