Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTIP2/BCL11B Rabbit mAb
MBS9147478-01 0.02 mL

CTIP2/BCL11B Rabbit mAb

Sign In for Pricing
View Details
CTIP2/BCL11B Rabbit mAb
MBS9147478-02 0.1 mL

CTIP2/BCL11B Rabbit mAb

Sign In for Pricing
View Details
CTIP2/BCL11B Rabbit mAb
MBS9147478-03 5x 0.1 mL

CTIP2/BCL11B Rabbit mAb

Sign In for Pricing
View Details
Micro β-galactosidase (β-GAL) Assay Kit
OM626074 100 Tests

Micro β-galactosidase (β-GAL) Assay Kit

Sign In for Pricing
View Details
FAM136BP (NM_001012983) Human Over-expression Lysate
LS387071-20ug 20 µg

FAM136BP (NM_001012983) Human Over-expression Lysate

Sign In for Pricing
View Details
E.coli mutY Recombinant Protein
PROTP17802-50ug 50 µg

E.coli mutY Recombinant Protein

Sign In for Pricing
View Details