Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47187114 3x 1.0 µg

Tnc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-23 Antibody (207) [DyLight 488]
NBP3-26067G 0.1 mL

Rabbit Monoclonal IL-23 Antibody (207) [DyLight 488]

Sign In for Pricing
View Details
GSC2 Antibody
E38PA1510 100 µL

GSC2 Antibody

Sign In for Pricing
View Details
Rabbit anti-PPP2R1A Antibody, Affinity Purified
A300-963A 20 µg

Rabbit anti-PPP2R1A Antibody, Affinity Purified

Sign In for Pricing
View Details
PASK (Phospho-Thr1165) Rabbit Polyclonal Antibody
E28PP1742 100 µL

PASK (Phospho-Thr1165) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
16α-Hydroxycorticosterone 21-Acetate
158911 2.5 mg

16α-Hydroxycorticosterone 21-Acetate

Sign In for Pricing
View Details