Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC499469 Rat shRNA Plasmid (Locus ID 499469)
TL703864 1 Kit

LOC499469 Rat shRNA Plasmid (Locus ID 499469)

Sign In for Pricing
View Details
Arr3 (BC017145) Mouse Tagged ORF Clone Lentiviral Particle
MR203296L3V 200 µL

Arr3 (BC017145) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Micb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6311008 1.0 µg DNA

Micb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
UBL7 Recombinant Protein (Human)
RP033799 100 µg

UBL7 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Human CEACAM-1/CD66a Protein
E900294P 10 µg

Recombinant Human CEACAM-1/CD66a Protein

Sign In for Pricing
View Details
Olr148 sgRNA CRISPR Lentivector set (Rat)
K7399101 3x 1.0 µg

Olr148 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details