Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AFY2 antibody
70R-2108 50 ug

H2AFY2 antibody

Sign In for Pricing
View Details
Human TDG Recombinant Protein
PPT-15603 100 µg

Human TDG Recombinant Protein

Sign In for Pricing
View Details
PAQR5 Antibody, HRP conjugated
A71013-100UG 100 µg

PAQR5 Antibody, HRP conjugated

Sign In for Pricing
View Details
SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405)
MBS6197956-01 0.1 mL

SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405)

Sign In for Pricing
View Details
SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405)
MBS6197956-02 5x 0.1 mL

SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral mouse Xk shRNA (UAS) - Lentiviral mouse Xk shRNA (UAS, GFP) plasmid
GTR15289390 1 Vial

Lentiviral mouse Xk shRNA (UAS) - Lentiviral mouse Xk shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details