Animal-Free MIP-2/CXCL2, Mouse (His)
MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html
Purity
95.0
Smiles
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Molecular Formula
20310 (Gene_ID) P10889 (A28-N100) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
XRCC6, CT (XRCC6, G22P1, X-ray repair cross-complementing protein 6, 5'-deoxyribose-5-phosphate lyase Ku70, 70kD subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, DNA repair protein XRCC6, Lupus Ku autoantigen protein p70, Thyroid-lupus autoantigen, X-ray repair complementing defective repair in Chinese hamster cells 6) (MaxLight 490) discontinued
![Recombinant ZIKV NS1 Protein (aa 796-1157) [His] (strain Zika SPH2015) (HEK293 Cells)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)