Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Metallothionein 1H (MT1H) ELISA Kit
MBS9902982 Inquire

Goose Metallothionein 1H (MT1H) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human POGK shRNA (UAS) - Lentiviral human POGK shRNA (UAS, iRFP) plasmid
GTR15122044 1 Vial

Lentiviral human POGK shRNA (UAS) - Lentiviral human POGK shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Bovine enin alpha-3 (CTNNA3) ELISA Kit
OM620630 96 Strip Well

Bovine enin alpha-3 (CTNNA3) ELISA Kit

Sign In for Pricing
View Details
RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (MaxLight 650)
250914-ML650 100 µL

RAX (Retina and anterior Neural fold Homeobox, MCOP3, RX) (MaxLight 650)

Sign In for Pricing
View Details
Dbt (NM_010022) Mouse Tagged ORF Clone
MR207721 10 µg

Dbt (NM_010022) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) ELISA Kit
abx504267 96 Tests

Mouse Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) ELISA Kit

Sign In for Pricing
View Details