Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEP HCl
TCEP1-50g 50 g

TCEP HCl

Sign In for Pricing
View Details
FAM149A (NM_001006655) Human 3' UTR Clone
SC208981 10 µg

FAM149A (NM_001006655) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse B7-H1/PD-L1 Alexa Fluor 350 Antibody (Clone 929903)
FAB9078U-100UG 100 µg

Mouse B7-H1/PD-L1 Alexa Fluor 350 Antibody (Clone 929903)

Sign In for Pricing
View Details
Human FCRLB/FCRY Alexa Fluor 488 Antibody (Clone 454217)
IC4705G-100UG 100 µg

Human FCRLB/FCRY Alexa Fluor 488 Antibody (Clone 454217)

Sign In for Pricing
View Details
TCEAL1 Antibody
A48878-100UL 100 µL

TCEAL1 Antibody

Sign In for Pricing
View Details
Mouse NQO1 Recombinant Protein (N-His)
MB232012-01 50 µg

Mouse NQO1 Recombinant Protein (N-His)

Sign In for Pricing
View Details