Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klra6 Protein Vector (Mouse) (pPM-C-HA)
PV194980 500 ng

Klra6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal CCR6 Antibody (876515R) [Janelia Fluor 549]
FAB8320RI 0.1 mL

Mouse Monoclonal CCR6 Antibody (876515R) [Janelia Fluor 549]

Sign In for Pricing
View Details
SLC17A8 Recombinant Protein (Human)
RP043378 100 µg

SLC17A8 Recombinant Protein (Human)

Sign In for Pricing
View Details
Usf1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4640003 1.0 µg DNA

Usf1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
IgG1 (Texas Red)
I1904-67F 1 mg

IgG1 (Texas Red)

Sign In for Pricing
View Details
RPL26P2 sgRNA CRISPR Lentivector set (Human)
K1948801 3x 1.0 µg

RPL26P2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details