Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFPL1 Rabbit Polyclonal Antibody
BT-AP13680-01 20 µL

ZFPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFPL1 Rabbit Polyclonal Antibody
BT-AP13680-02 50 µL

ZFPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFPL1 Rabbit Polyclonal Antibody
BT-AP13680-03 100 µL

ZFPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OCP1 AAV siRNA Pooled Vector
63056161 1.0 µg

OCP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit anti-Beta-2-adaptin Antibody, Affinity Purified
A304-719A 100 µg

Rabbit anti-Beta-2-adaptin Antibody, Affinity Purified

Sign In for Pricing
View Details
Ubiquitin (Ub, Ubiquitin, human specificity) ELISA Kit
hUb-ELISA 96 Tests

Ubiquitin (Ub, Ubiquitin, human specificity) ELISA Kit

Sign In for Pricing
View Details