Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans C03B1.6 Polyclonal Antibody
MBS7188689 Inquire

Rabbit anti-Caenorhabditis elegans C03B1.6 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM14C Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV659262 1.0 µg DNA

TMEM14C Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Neuropeptide FF (NPFF) ELISA Kit
JL30206-01 48 Tests

Mouse Neuropeptide FF (NPFF) ELISA Kit

Sign In for Pricing
View Details
Mouse Neuropeptide FF (NPFF) ELISA Kit
JL30206-02 96 Tests

Mouse Neuropeptide FF (NPFF) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Lrrc43 shRNA (UAS) - Lentiviral mouse Lrrc43 shRNA (UAS, RFP) (25)
GTR15278135 1 Vial

Lentiviral mouse Lrrc43 shRNA (UAS) - Lentiviral mouse Lrrc43 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
KIF25 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF505433 100 µg

KIF25 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

Sign In for Pricing
View Details