Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDX4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV690983 1.0 µg DNA

PRDX4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Man1a2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3656903 1.0 µg DNA

Man1a2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
KCNF1 Double Nickase Plasmid (m)
sc-436398-NIC 20 µg

KCNF1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Nagk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3232007 1.0 µg DNA

Nagk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Diversey ClearKlens Cleansinald Detergent Disinfectant VH9S 900mL Spray Bottles
SAF5190 6 / PCK

Diversey ClearKlens Cleansinald Detergent Disinfectant VH9S 900mL Spray Bottles

Sign In for Pricing
View Details
APOF Protein Vector (Human) (pPB-His-MBP)
PV322906 500 ng

APOF Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details