Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GRAMD1B Pre-designed siRNA Set B
SI006601B 1 Each

Human GRAMD1B Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ubxn8 (NM_001106086) Rat Tagged Lenti ORF Clone
RR208306L3 10 µg

Ubxn8 (NM_001106086) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DGN549-L
HY-145365 1 Each

DGN549-L

Sign In for Pricing
View Details
CHMP1B Polyclonal Antibody, HRP Conjugated
bs-7789R-HRP 100 µL

CHMP1B Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (AP) discontinued
128757-AP 100 µL

KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (AP) discontinued

Sign In for Pricing
View Details
p300 Antibody
MBS8511991-01 0.05 mg

p300 Antibody

Sign In for Pricing
View Details