Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CytoPak GMP Human IL-2 Protein
GMP-L02H14GB01-15x10^6IU 15x 10^6 IU

CytoPak GMP Human IL-2 Protein

Sign In for Pricing
View Details
Syntenin 2 (SDCBP2) (NM_080489) Human Over-expression Lysate
LY409179 100 µg

Syntenin 2 (SDCBP2) (NM_080489) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC δ Rabbit mAb
E60M0545 100 µL

PKC δ Rabbit mAb

Sign In for Pricing
View Details
TMEM91 (Transmembrane Protein 91)
494155 100 µL

TMEM91 (Transmembrane Protein 91)

Sign In for Pricing
View Details
(S) -Valiolamine Voglibose
RM-V071206-01 10 mg

(S) -Valiolamine Voglibose

Sign In for Pricing
View Details
(S) -Valiolamine Voglibose
RM-V071206-02 25 mg

(S) -Valiolamine Voglibose

Sign In for Pricing
View Details