Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free MIP-2/CXCL2, Mouse (His)

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.Animal-Free MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIP-2/CXCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-mip-2-cxcl2-protein-mouse-his.html

Purity

95.0

Smiles

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (A28-N100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS3 Protein Vector (Human) (pPB-C-His)
PV039561 500 ng

SOCS3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
AK1C4 Polyclonal Antibody
JOT-AP06132-01 50ul

AK1C4 Polyclonal Antibody

Sign In for Pricing
View Details
AK1C4 Polyclonal Antibody
JOT-AP06132-02 100ul

AK1C4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD340/ERBB2/HER2/NEU (DHES0815A) Biosimilar (Monoclonal, IgG)
A136345 100 µL

Anti-CD340/ERBB2/HER2/NEU (DHES0815A) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Tcf20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4967105 3x 1.0 µg

Tcf20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cpz (NM_031766) Rat Tagged ORF Clone
RR212915 10 µg

Cpz (NM_031766) Rat Tagged ORF Clone

Sign In for Pricing
View Details