Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (Azide free) (HRP) discontinued
034074-HRP 200 µL

COG2, NT (COG2, LDLC, Conserved oligomeric Golgi complex subunit 2, Component of oligomeric Golgi complex 2, Low density lipoprotein receptor defect C-complementing protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Hemagglutinin Tag (YPYDVPDYA) (HA Tag) (MaxLight 750) discontinued
H1847-51G-ML750 100 µL

Hemagglutinin Tag (YPYDVPDYA) (HA Tag) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TMEM214 CRISPRa sgRNA lentivector (set of three targets)(Rat)
47002126 3x 1.0µg DNA

TMEM214 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rat P27 protein ELISA Kit
ERP0586 96 Tests

Rat P27 protein ELISA Kit

Sign In for Pricing
View Details
Recombinant Anti-CD135 Rabbit mAb
CMA9475-01 30 µL

Recombinant Anti-CD135 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-CD135 Rabbit mAb
CMA9475-02 50 μL

Recombinant Anti-CD135 Rabbit mAb

Sign In for Pricing
View Details