Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-1906 miRNA Antagomir
CIN0599-01 10 nmol

Mmu-miR-1906 miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-1906 miRNA Antagomir
CIN0599-02 20 nmol

Mmu-miR-1906 miRNA Antagomir

Sign In for Pricing
View Details
DDIT4 Rabbit Polyclonal Antibody
E53P12239 100 µL

DDIT4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ppp1r2 shRNA (UAS) - Lentiviral mouse Ppp1r2 shRNA (UAS, GFP) (100)
GTR15166065 1 Vial

Lentiviral mouse Ppp1r2 shRNA (UAS) - Lentiviral mouse Ppp1r2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PRLR Protein, Mouse, Recombinant (His)
MF-0106388-01 5 µg

PRLR Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
PRLR Protein, Mouse, Recombinant (His)
MF-0106388-02 10 µg

PRLR Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details