Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Calpain 5
YF-PA10573 50 ul

anti-Calpain 5

Sign In for Pricing
View Details
Mouse Monoclonal gamma-2 Tubulin Antibody (4F6)
H00027175-M01 0.1 mg

Mouse Monoclonal gamma-2 Tubulin Antibody (4F6)

Sign In for Pricing
View Details
ZDH22 rabbit pAb
UB-GEN-8444 100 µL

ZDH22 rabbit pAb

Sign In for Pricing
View Details
Mouse Marveld3 Pre-designed siRNA Set A
SI108186A 1 Each

Mouse Marveld3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SLC41A2 Human siRNA Oligo Duplex (Locus ID 84102)
SR325286 1 Kit

SLC41A2 Human siRNA Oligo Duplex (Locus ID 84102)

Sign In for Pricing
View Details
Anti-CEACAM5 (Altumomab)-SPDB-DM4 ADC
ADC-W-969 1 mg

Anti-CEACAM5 (Altumomab)-SPDB-DM4 ADC

Sign In for Pricing
View Details