Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (HRP)
MBS6473126-01 0.2 mL

DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (HRP)

Sign In for Pricing
View Details
DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (HRP)
MBS6473126-02 5x 0.2 mL

DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (HRP)

Sign In for Pricing
View Details
KLRG1, 60-189aa, Human, His tag, E.coli
E53A02757 50 µg

KLRG1, 60-189aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Mouse anti-Rubella Virus IgG (DD5)
MAB12516-500 1 Each

Mouse anti-Rubella Virus IgG (DD5)

Sign In for Pricing
View Details
MYO9A (Unconventional Myosin-IXa, Unconventional Myosin-9a, MYR7, FLJ11061, FLJ13244, MGC71859) (PE)
130078-PE 100 µL

MYO9A (Unconventional Myosin-IXa, Unconventional Myosin-9a, MYR7, FLJ11061, FLJ13244, MGC71859) (PE)

Sign In for Pricing
View Details
STO-609
B1609-25 25 mg

STO-609

Sign In for Pricing
View Details