Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSIP1 polyclonal antibody
BS76057-01 50 µL

FSIP1 polyclonal antibody

Sign In for Pricing
View Details
FSIP1 polyclonal antibody
BS76057-02 100 µL

FSIP1 polyclonal antibody

Sign In for Pricing
View Details
SHCBP1L ORF Vector (Human) (pORF)
ORF032271 1.0 µg DNA

SHCBP1L ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)
HV599010-01 50 µg

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

Sign In for Pricing
View Details
InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)
HV599010-02 100 µg

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

Sign In for Pricing
View Details
InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)
HV599010-03 1 mg

InVivoMAb Anti-Human CD268/TNFRSF13C Antibody (CB3s)

Sign In for Pricing
View Details