Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (3-Oxooctanoyl) -L-homoserine lactone
GK8784-100mg 100 mg

N- (3-Oxooctanoyl) -L-homoserine lactone

Sign In for Pricing
View Details
Mouse Tfb1m ELISA Kit
EF014697 96 Tests

Mouse Tfb1m ELISA Kit

Sign In for Pricing
View Details
SPRN (NM_001012508) Human Tagged ORF Clone Lentiviral Particle
RC207257L1V 200 µL

SPRN (NM_001012508) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ube2e3 (NM_001047857) Rat Untagged Clone
RN207874 10 µg

Ube2e3 (NM_001047857) Rat Untagged Clone

Sign In for Pricing
View Details
Mouse Tail Genomic DNA Extraction Kit (250)
M9100-250 250 Preparations

Mouse Tail Genomic DNA Extraction Kit (250)

Sign In for Pricing
View Details
TRHDE Protein Vector (Rat) (pPB-N-His)
PV312819 500 ng

TRHDE Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details