Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Beclin 2 Antibody [Alexa Fluor 532]
NB110-60982AF532 0.1 mL

Rabbit Polyclonal Beclin 2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
RPL18A AAV Vector (Human) (CMV)
40921102 1 µg

RPL18A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GPR20 (NM_005293) Human Untagged Clone
SC116800 10 µg

GPR20 (NM_005293) Human Untagged Clone

Sign In for Pricing
View Details
CS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV679231 1.0 µg DNA

CS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Shigella Boydii cof Protein (aa 1-272)
VAng-Lsx09062-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii cof Protein (aa 1-272)

Sign In for Pricing
View Details
Human CD314 Antibody Conjugated to FITC
B2014711 50 µg

Human CD314 Antibody Conjugated to FITC

Sign In for Pricing
View Details