Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1RL2 Protein, Mouse (A158V, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1rl2-protein-mouse-a158v-hek293-his.html

Purity

95.0

Smiles

DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

Molecular Formula

107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

Molecular Weight

50-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5C1 sgRNA CRISPR Lentivector set (Human)
K0147701 3x 1.0 µg

ATP5C1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Coronin 3 (CORO1C) Human siRNA Oligo Duplex (Locus ID 23603)
SR308397 1 Kit

Coronin 3 (CORO1C) Human siRNA Oligo Duplex (Locus ID 23603)

Sign In for Pricing
View Details
RNF168, CT (RNF168, E3 ubiquitin-protein ligase RNF168, RING finger protein 168)
MBS6002112-01 0.2 mL

RNF168, CT (RNF168, E3 ubiquitin-protein ligase RNF168, RING finger protein 168)

Sign In for Pricing
View Details
RNF168, CT (RNF168, E3 ubiquitin-protein ligase RNF168, RING finger protein 168)
MBS6002112-02 5x 0.2 mL

RNF168, CT (RNF168, E3 ubiquitin-protein ligase RNF168, RING finger protein 168)

Sign In for Pricing
View Details
(3alpha,5beta,7beta)-Cholane-3,7,24-triol
TRC-C292530-100MG 100 mg

(3alpha,5beta,7beta)-Cholane-3,7,24-triol

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody
RD22267F-01 50 µg

AF/LE Purified Anti-Mouse H-2 Antibody

Sign In for Pricing
View Details