Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RII/TNFRSF1B, Human (183a.a, HEK293, mFc)

TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Human (183a.a, HEK293, mFc) is expressed by HEK293 and has a transmembrane region (P24-T206) with mFc tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNF RII/TNFRSF1B Protein, Human (183a.a, HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-rii-tnfrsf1b-protein-human-183a-a-hek293-mfc.html

Purity

99.90

Smiles

PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT

Molecular Formula

7133 (Gene_ID) P20333-1 (P24-T206) (Accession)

Molecular Weight

Approximately 60.0 kDa

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fotin-Mleczek M, et, al. Apoptotic crosstalk of TNF receptors: TNF-R2-induces depletion of TRAF2 and IAP proteins and accelerates TNF-R1-dependent activation of caspase-8. J Cell Sci. 2002 Jul 1;115 (Pt 13) :2757-70.|[3]Masli S, et, al. Anti-inflammatory effects of tumour necrosis factor (TNF) -alpha are mediated via TNF-R2 (p75) in tolerogenic transforming growth factor-beta-treated antigen-presenting cells. Immunology. 2009 May;127 (1) :62-72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXE1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0446R-BF680-TR 20 µL

FOXE1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Ranibizumab (Anti-VEGFA)
A2305-1mg*25 25x 1 mg

Ranibizumab (Anti-VEGFA)

Sign In for Pricing
View Details
Mouse Inpp5a qPCR Primer Pair
QM54650S 200 Tests

Mouse Inpp5a qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal dedicator of cytokinesis 8 Antibody (OTI12D7) [DyLight 755]
NBP2-72227IR 0.1 mL

Mouse Monoclonal dedicator of cytokinesis 8 Antibody (OTI12D7) [DyLight 755]

Sign In for Pricing
View Details
Rabbit Polyclonal SARS-CoV-2 3CL Protease Antibody [Janelia Fluor 549]
NBP3-07062JF549 0.1 mL

Rabbit Polyclonal SARS-CoV-2 3CL Protease Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Brazikumab Biosimilar - Research Grade
ICH5413-25mg 25 mg

Brazikumab Biosimilar - Research Grade

Sign In for Pricing
View Details