Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N-terminal 6xHis-SUMO-tagged

Product Specifications

Abbreviation

N-terminal 6xHis-SUMO-tagged protein

Target Sequence

MMAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
More Discoveries

Explore Other Products

Browse additional items from our catalog

TBXAS1 AAV Vector (Human) (CMV)
46314101 1 µg

TBXAS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
LOX-1 Antibody (Soluble)
GWB-1D6169 0.2 mg

LOX-1 Antibody (Soluble)

Sign In for Pricing
View Details
OR51B8P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV739085 1.0 µg DNA

OR51B8P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Bspry (NM_138653) Mouse Tagged ORF Clone Lentiviral Particle
MR221167L4V 200 µL

Bspry (NM_138653) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SOCS3 Conjugated Antibody
MBS9448440-01 0.1 mL (Biotin)

SOCS3 Conjugated Antibody

Sign In for Pricing
View Details
SOCS3 Conjugated Antibody
MBS9448440-02 0.1 mL (AF350)

SOCS3 Conjugated Antibody

Sign In for Pricing
View Details