Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin B3, Human (HEK293, His)

The Serpin B3 protein exhibits versatility in cellular regulation and may act as a papain-like cysteine protease inhibitor to modulate immune responses against tumor cells. Its dual role extends to inhibiting UV-induced apoptosis by inhibiting c-Jun NH (2) -terminal kinase (JNK1) activity, suggesting that Serpin B3 is involved in the stress response. Serpin B3 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin B3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-b3-protein-human-hek-293-his.html

Purity

98.0

Smiles

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Molecular Formula

6317 (Gene_ID) P29508 (M1-P390) (Accession)

Molecular Weight

41-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PFTK1 Antibody [DyLight 755]
NBP3-06062IR 0.1 mL

Rabbit Polyclonal PFTK1 Antibody [DyLight 755]

Sign In for Pricing
View Details
GRID2IP (NM_001145118) Human Tagged ORF Clone Lentiviral Particle
RC227339L3V 200 µL

GRID2IP (NM_001145118) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IER3IP1 (NM_016097) Human Tagged ORF Clone Lentiviral Particle
RC203042L4V 200 µL

IER3IP1 (NM_016097) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Triosephosphate isomerase Antibody
abx431681 200 µL

Triosephosphate isomerase Antibody

Sign In for Pricing
View Details
Cystatin C Monoclonal Antibody, PE-Cy7 Conjugated
bsm-33286M-PE-Cy7 100 µL

Cystatin C Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Human PSMB9 (NM_002800) AAV Particle
RC209001A1V 250 µL

Human PSMB9 (NM_002800) AAV Particle

Sign In for Pricing
View Details