Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin B3, Human (HEK293, His)

The Serpin B3 protein exhibits versatility in cellular regulation and may act as a papain-like cysteine protease inhibitor to modulate immune responses against tumor cells. Its dual role extends to inhibiting UV-induced apoptosis by inhibiting c-Jun NH (2) -terminal kinase (JNK1) activity, suggesting that Serpin B3 is involved in the stress response. Serpin B3 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin B3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-b3-protein-human-hek-293-his.html

Purity

98.0

Smiles

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Molecular Formula

6317 (Gene_ID) P29508 (M1-P390) (Accession)

Molecular Weight

41-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details