Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-7, Human (HEK293, His)

Kallikrein-7 is a serine protease with chymotrypsin-like activity that plays a role in intercellular proteolysis, leading to epidermal exfoliation. It is involved in cancer invasion and metastasis, and elevated expression is associated with poor prognosis and cancer progression. Kallikrein-7 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klk7-kallikrein-7-protein-human-hek293-his.html

Purity

95.80

Smiles

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

Molecular Formula

5650 (Gene_ID) NP_005037.1 (E23-R253) (Accession)

Molecular Weight

30-33 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-7 ELISA Kit, pink-ONE
K0332137P 96 Well

Mouse IL-7 ELISA Kit, pink-ONE

Sign In for Pricing
View Details
CD299 (CLEC4M) (NM_214675) Human Recombinant Protein
PH36804M5 20 µg

CD299 (CLEC4M) (NM_214675) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)
MBS1197840-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)
MBS1197840-02 0.02 mg (Yeast)

Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)
MBS1197840-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)
MBS1197840-04 0.1 mg (Yeast)

Recombinant Escherichia coli O139:H28 Probable cytosol aminopeptidase (pepA)

Sign In for Pricing
View Details