Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-23, Human (His)

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. Animal-Free FGF-23 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-23 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-23 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-23-protein-human-his.html

Purity

98.00

Smiles

MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Formula

8074 (Gene_ID) Q9GZV9 (Y25-F251) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenobarbital antibody
20-PR15 1 ml

Phenobarbital antibody

Sign In for Pricing
View Details
MCP-3 (Monocyte Chemotactic Protein 3) BioAssayTM ELISA Kit (Mouse) discontinued
383643 96 Tests

MCP-3 (Monocyte Chemotactic Protein 3) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Mouse TAF1D shRNA Plasmid
abx978376-01 150 µg

Mouse TAF1D shRNA Plasmid

Sign In for Pricing
View Details
Mouse TAF1D shRNA Plasmid
abx978376-02 300 µg

Mouse TAF1D shRNA Plasmid

Sign In for Pricing
View Details
PIN1 Antibody
orb192512-01 50 μL

PIN1 Antibody

Sign In for Pricing
View Details
PIN1 Antibody
orb192512-02 100 µL

PIN1 Antibody

Sign In for Pricing
View Details