Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zika virus E/Envelope (Biotinylated, HEK293, His)

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His, Biotinylated) is the recombinant virus-derived Zika virus E/Envelope, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

Zika virus E/Envelope Protein (Biotinylated, HEK293, His), Virus, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/zika-virus-e-envelope-protein-hek293-his-biotinylated.html

Smiles

VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

Molecular Formula

/ (Gene_ID) ALU33341 (V593-K699) (Accession)

Molecular Weight

Approximately 13 kDa

References & Citations

[1]Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb) . 2023 Jun 6;59 (46) :6946-6955.|[2]Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phaseolus vulgaris Lectin (PHA-L) - Separopore® 4B MicroPass™
21511136-1 300 µL

Phaseolus vulgaris Lectin (PHA-L) - Separopore® 4B MicroPass™

Sign In for Pricing
View Details
Zebrafish Rab18a Rabbit Polyclonal Antibody (Cy3)
orb2573330 200 µL

Zebrafish Rab18a Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
2-Amino-4-bromopyridine
TRC-A601870-1G 1 g

2-Amino-4-bromopyridine

Sign In for Pricing
View Details
GGA3 (NM_138619) Human Recombinant Protein
E45H36380M5 20 µg

GGA3 (NM_138619) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human CCDC102B sgRNA gene knockout kit - Lentiviral human CCDC102B sgRNA gene knockout kit (plasmid)
GTR15369953 1 Vial

Lentiviral human CCDC102B sgRNA gene knockout kit - Lentiviral human CCDC102B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SPR Rabbit pAb
A11694-01 20 µL

SPR Rabbit pAb

Sign In for Pricing
View Details