Zika virus E/Envelope (Biotinylated, HEK293, His)
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His, Biotinylated) is the recombinant virus-derived Zika virus E/Envelope, expressed by HEK293, with C-His labeled tag.
Product Specifications
Product Name Alternative
Zika virus E/Envelope Protein (Biotinylated, HEK293, His), Virus, HEK293
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/zika-virus-e-envelope-protein-hek293-his-biotinylated.html
Smiles
VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK
Molecular Formula
/ (Gene_ID) ALU33341 (V593-K699) (Accession)
Molecular Weight
Approximately 13 kDa
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Magic™ Membrane Protein Human NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13) Full Length
Recombinant Bacteroides fragilis Cytochrome c-552 (nrfA)
Recombinant Bacteroides fragilis Cytochrome c-552 (nrfA)
Recombinant Bacteroides fragilis Cytochrome c-552 (nrfA)