Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Small capsomere-interacting protein (SCP)

Product Specifications

Abbreviation

Recombinant Human herpesvirus 2 SCP protein

Gene Name

SCP

UniProt

P89458

Expression Region

1-112aa

Organism

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Target Sequence

MAAPQFHRPSTITADNVRALGMRGLVLATNNAQFIMDNSYPHPHGTQGAVREFLRGQAAALTDLGVTHANNTFAPQPMFAGDAAAEWLRPSFGLKRTYSPFVVRDPKTPSTP

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.UniRule Annotation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PIGT Rabbit pAb
GB114442-100 100 μL

Anti-PIGT Rabbit pAb

Sign In for Pricing
View Details
Mmu-miR-6903-3p mimic
HY-R03526-01 5 nmol

Mmu-miR-6903-3p mimic

Sign In for Pricing
View Details
Mmu-miR-6903-3p mimic
HY-R03526-02 20 nmol

Mmu-miR-6903-3p mimic

Sign In for Pricing
View Details
THAP11 cDNA Clone
MBS1271928-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

THAP11 cDNA Clone

Sign In for Pricing
View Details
THAP11 cDNA Clone
MBS1271928-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

THAP11 cDNA Clone

Sign In for Pricing
View Details
Rabbit Polyclonal to Human GPRC5C
MBS243971-01 0.05 mg

Rabbit Polyclonal to Human GPRC5C

Sign In for Pricing
View Details