Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER2/CD340, Rat (His)

The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HER2/CD340 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erbb2-her2-protein-rat-his.html

Purity

95.0

Smiles

ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV

Molecular Formula

24337 (Gene_ID) P06494 (A67-V323) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOVL2 Antibody, FITC conjugated
A71010-50UG 50 µg

ELOVL2 Antibody, FITC conjugated

Sign In for Pricing
View Details
TUBA1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48792061 1.0 µg DNA

TUBA1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRNAS3 AAV siRNA Pooled Vector
48386161 1.0 µg

TRNAS3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GOLGA9P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0882605 3x 1.0 µg

GOLGA9P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rat Gpn2 Pre-designed siRNA Set B
SI205794B 1 Each

Rat Gpn2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Vbp1 Mouse qPCR Primer Pair (NM_011692)
MP218401 200 Reactions

Vbp1 Mouse qPCR Primer Pair (NM_011692)

Sign In for Pricing
View Details