Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-01 0.5 mg (E-Coli)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details
Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-02 0.05 mg (Baculovirus)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details
Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-03 0.5 mg (Yeast)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details
Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-04 0.05 mg (Mammalian-Cell)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details
Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-05 1 mg (E-Coli)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details
Recombinant Human BET1-like protein (BET1L), partial
MBS1487734-06 0.1 mg (Baculovirus)

Recombinant Human BET1-like protein (BET1L), partial

Sign In for Pricing
View Details