Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Basp1 (NM_022300) Rat Tagged ORF Clone
RR211144 10 µg

Basp1 (NM_022300) Rat Tagged ORF Clone

Sign In for Pricing
View Details
LDC1267
C18008 100 mg

LDC1267

Sign In for Pricing
View Details
RGS9BP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
39489111 3x 1.0 µg

RGS9BP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rhof ORF Vector (Mouse) (pORF)
ORF056011 1.0 µg DNA

Rhof ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Elastin Microfibril Interface Located Protein 1 (EMILIN1)
MBS2042147-01 0.1 mL

APC-Linked Polyclonal Antibody to Elastin Microfibril Interface Located Protein 1 (EMILIN1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Elastin Microfibril Interface Located Protein 1 (EMILIN1)
MBS2042147-02 0.2 mL

APC-Linked Polyclonal Antibody to Elastin Microfibril Interface Located Protein 1 (EMILIN1)

Sign In for Pricing
View Details