Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHP, 1-195aa, Human, His tag, E.coli
E53A01613 50 µg

CHP, 1-195aa, Human, His tag, E.coli

Sign In for Pricing
View Details
SCN3A (NM_001081677) Human Untagged Clone
SC316038 10 µg

SCN3A (NM_001081677) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) NAPF Polyclonal Antibody
MBS7163241 Inquire

Rabbit anti-Escherichia coli (strain K12) NAPF Polyclonal Antibody

Sign In for Pricing
View Details
TRNAL10 sgRNA CRISPR Lentivector (Human) (Target 1)
K2500802 1.0 µg DNA

TRNAL10 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit anti Human HDAC1
X1879P 100 µg

Rabbit anti Human HDAC1

Sign In for Pricing
View Details
Mouse Serpin A12 (SERPINA12) ELISA Kit
abx513785 96 Well

Mouse Serpin A12 (SERPINA12) ELISA Kit

Sign In for Pricing
View Details