Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPL Protein Vector (Human) (pPB-C-His)
PV028717 500 ng

NPL Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD72 Human siRNA Oligo Duplex (Locus ID 971)
SR319631 1 Kit

CD72 Human siRNA Oligo Duplex (Locus ID 971)

Sign In for Pricing
View Details
Human HNF1B knockdown cell line
ABC-KD6901 1 Vial

Human HNF1B knockdown cell line

Sign In for Pricing
View Details
Ortho-Methylfentanyl (hydrochloride)
MF-0129513-01 10 mg

Ortho-Methylfentanyl (hydrochloride)

Sign In for Pricing
View Details
Ortho-Methylfentanyl (hydrochloride)
MF-0129513-02 50 mg

Ortho-Methylfentanyl (hydrochloride)

Sign In for Pricing
View Details
Visceral Adipose Tissue Derived Serine Protease Inhibitor (Biotin)
550652 200 µL

Visceral Adipose Tissue Derived Serine Protease Inhibitor (Biotin)

Sign In for Pricing
View Details