Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFR2 Reporter Jurkat Cell Line
ABC-RC069F 1 Vial

TNFR2 Reporter Jurkat Cell Line

Sign In for Pricing
View Details
ACVR2B, Recombinant, Human, His-Tag discontinued
047169-01 10 µg

ACVR2B, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
ACVR2B, Recombinant, Human, His-Tag discontinued
047169-02 50 µg

ACVR2B, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
GRPEL2 Protein Vector (Rat) (pPB-C-His)
PV271686 500 ng

GRPEL2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Monkey Mitofusin-1 (MFN1) ELISA Kit
MBS9395926-01 48 Well

Monkey Mitofusin-1 (MFN1) ELISA Kit

Sign In for Pricing
View Details
Monkey Mitofusin-1 (MFN1) ELISA Kit
MBS9395926-02 96 Well

Monkey Mitofusin-1 (MFN1) ELISA Kit

Sign In for Pricing
View Details