Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C-Reactive Protein,CRP;PTX1 ELISA KIT
JOT-EK0053Ra 96 wells

Rat C-Reactive Protein,CRP;PTX1 ELISA KIT

Sign In for Pricing
View Details
Apoptosis repressor with CARD (NOL3) Rabbit Polyclonal Antibody
TA312124 100 µL

Apoptosis repressor with CARD (NOL3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF160 Polyclonal Antibody, RBITC Conjugated
bs-8376R-RBITC 100 µL

RNF160 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PKD2 (Protein Kinase D2) N) Human ELISA Kit
F9118 96 Tests

PKD2 (Protein Kinase D2) N) Human ELISA Kit

Sign In for Pricing
View Details
Cytomegalovirus Early Nuclear Antigen Antibody
GWB-E79586 0.1 mg

Cytomegalovirus Early Nuclear Antigen Antibody

Sign In for Pricing
View Details
Rat total Procollagen Type I Intact N-terminal Propeptide (total-P1NP) ELISA K
QY-E10457 96 Tests

Rat total Procollagen Type I Intact N-terminal Propeptide (total-P1NP) ELISA K

Sign In for Pricing
View Details