Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhbdl3 Mouse shRNA Lentiviral Particle (Locus ID 246104)
TL517450V 500 µL Each

Rhbdl3 Mouse shRNA Lentiviral Particle (Locus ID 246104)

Sign In for Pricing
View Details
COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (MaxLight 405) discontinued
125257-ML405 100 µL

COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Quick Step Human Nesfatin-1 ELISA Kit
QS2458Hu-01 48 Tests

Quick Step Human Nesfatin-1 ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Nesfatin-1 ELISA Kit
QS2458Hu-02 96 Tests

Quick Step Human Nesfatin-1 ELISA Kit

Sign In for Pricing
View Details
UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6) (MaxLight 490)
MBS6361053-01 0.1 mL

UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6) (MaxLight 490)

Sign In for Pricing
View Details
UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6) (MaxLight 490)
MBS6361053-02 5x 0.1 mL

UBXN8, NT (UBXN8, D8S2298E, REP8, UBXD6, UBX domain-containing protein 8, Reproduction 8 protein, UBX domain-containing protein 6) (MaxLight 490)

Sign In for Pricing
View Details