Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 discontinued
395421 200 µL

TLR4 discontinued

Sign In for Pricing
View Details
pCMV-C1QB-Myc Plasmid
PVT60887 2 µg

pCMV-C1QB-Myc Plasmid

Sign In for Pricing
View Details
Human Transmembrane protein 92 (TMEM92) ELISA Kit
abx550597 96 Tests

Human Transmembrane protein 92 (TMEM92) ELISA Kit

Sign In for Pricing
View Details
Mouse Sh3bp5l Pre-designed siRNA Set B
SI112854B 1 Each

Mouse Sh3bp5l Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rat Polyamine-modulated factor 1-binding protein 1, PMFBP1 ELISA KIT
E0980Ra-01 48 Well

Rat Polyamine-modulated factor 1-binding protein 1, PMFBP1 ELISA KIT

Sign In for Pricing
View Details
Rat Polyamine-modulated factor 1-binding protein 1, PMFBP1 ELISA KIT
E0980Ra-02 96 Well

Rat Polyamine-modulated factor 1-binding protein 1, PMFBP1 ELISA KIT

Sign In for Pricing
View Details