Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAC10 sgRNA CRISPR Lentivector set (Human)
K2477701 3x 1.0 µg

TRNAC10 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
RWDD1 Rabbit Polyclonal Antibody
E28PN7393 100 µL

RWDD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)
247775-ML550 100 µL

JAG2 (Jagged 2, HJ2, SER2) (MaxLight 550)

Sign In for Pricing
View Details
MARCO Rabbit Monoclonal Antibody
AMRe87424-01 1 Each

MARCO Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MARCO Rabbit Monoclonal Antibody
AMRe87424-02 50 µL

MARCO Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MARCO Rabbit Monoclonal Antibody
AMRe87424-03 100 µL

MARCO Rabbit Monoclonal Antibody

Sign In for Pricing
View Details