Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100365976 3'UTR Luciferase Stable Cell Line
TU209710 1.0 mL

LOC100365976 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ASCL2 Peptide
MBS3228335-01 0.1 mg

ASCL2 Peptide

Sign In for Pricing
View Details
ASCL2 Peptide
MBS3228335-02 5x 0.1 mg

ASCL2 Peptide

Sign In for Pricing
View Details
Epha10 (NM_001135709) Rat Untagged Clone
RN200712 10 µg

Epha10 (NM_001135709) Rat Untagged Clone

Sign In for Pricing
View Details
ENO1P4 3'UTR Luciferase Stable Cell Line
TU006900 1.0 mL

ENO1P4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BubR1 (BUB1B) mouse monoclonal antibody, clone 2G5, Purified
AM20433PU-N 50 µg

BubR1 (BUB1B) mouse monoclonal antibody, clone 2G5, Purified

Sign In for Pricing
View Details