Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM2A (NM_000405) Human Recombinant Protein
TP302452 20 µg

GM2A (NM_000405) Human Recombinant Protein

Sign In for Pricing
View Details
Human Stomach Cancer HS0017
HS0017 6 Slides/Pack

Human Stomach Cancer HS0017

Sign In for Pricing
View Details
PMN (Polymorphonuclear Leukocytes, PML) (Biotin)
138227-Biotin 100 µL

PMN (Polymorphonuclear Leukocytes, PML) (Biotin)

Sign In for Pricing
View Details
SacI
E1037-A 100 Reactions

SacI

Sign In for Pricing
View Details
MIR4437 Human MicroRNA Expression Plasmid (MI0016778)
SC401656 10 µg

MIR4437 Human MicroRNA Expression Plasmid (MI0016778)

Sign In for Pricing
View Details
CSAD (NM_015989) Human Over-expression Lysate
LY432285 100 µg

CSAD (NM_015989) Human Over-expression Lysate

Sign In for Pricing
View Details