Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane porin C/OmpC, E.coli (His-SUMO)

Outer membrane porin C (OmpC) functions as a channel, creating pores that facilitate passive diffusion of small molecules across the bacterial outer membrane. In the context of microbial infection, OmpC plays a role in supporting the entry of colicin E5 even in the absence of its primary receptor OmpF. Outer membrane porin C/OmpC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane porin C/OmpC protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Outer membrane porin C/OmpC Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-porin-c-ompc-protein-e-coli-his-sumo.html

Purity

90.00

Smiles

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Molecular Formula

946716 (Gene_ID) P06996 (A22-F367) (Accession)

Molecular Weight

Approximately 54.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4G Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43354064 1.0 µg DNA

SEMA4G Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FLT4 (NM_002020) Human Mutant ORF Clone
RC402577 10 µg

FLT4 (NM_002020) Human Mutant ORF Clone

Sign In for Pricing
View Details
Tape, Micropore, Surgical
43060058-2 12 Each

Tape, Micropore, Surgical

Sign In for Pricing
View Details
Lentiviral mouse Itgb2 shRNA (UAS) - Lentiviral mouse Itgb2 shRNA (UAS) (25)
GTR15288017 1 Vial

Lentiviral mouse Itgb2 shRNA (UAS) - Lentiviral mouse Itgb2 shRNA (UAS) (25)

Sign In for Pricing
View Details
CD94 (KLRD1) Human siRNA Oligo Duplex (Locus ID 3824)
SR302586 1 Kit

CD94 (KLRD1) Human siRNA Oligo Duplex (Locus ID 3824)

Sign In for Pricing
View Details
Cytokeratin 15 Rabbit pAb
E47R1772 100 µL

Cytokeratin 15 Rabbit pAb

Sign In for Pricing
View Details