Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSP, Human

AHSP proteins are chaperones in developing red blood cells that protect alpha-hemoglobin from harmful aggregation and precipitation. It is essential for alpha-hemoglobin stability, and it regulates conditions associated with excess alpha-hemoglobin, such as beta-thalassemia. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

AHSP Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ahsp-protein-human.html

Purity

98.0

Smiles

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Molecular Formula

51327 (Gene_ID) Q9NZD4 (M1-S102) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), CF640R conjugate, 0.1mg/mL
BNC403273-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHISA9 (NM_001145204) Human Over-expression Lysate
LY428750 100 µg

SHISA9 (NM_001145204) Human Over-expression Lysate

Sign In for Pricing
View Details
CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G5]
TA500652AM 100 µL

CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G5]

Sign In for Pricing
View Details
UCP1 Recombinant Rabbit monoclonal Antibody
HA751580 100 µL

UCP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Goat IgG (H&L) Antibody ATTO 647N Conjugated Pre-Adsorbed
TA397639 500 µg

Goat IgG (H&L) Antibody ATTO 647N Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Zdhhc1 Mouse Gene Knockout Kit (CRISPR)
KN519674 1 Kit

Zdhhc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details