Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHSP, Human

AHSP proteins are chaperones in developing red blood cells that protect alpha-hemoglobin from harmful aggregation and precipitation. It is essential for alpha-hemoglobin stability, and it regulates conditions associated with excess alpha-hemoglobin, such as beta-thalassemia. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

AHSP Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ahsp-protein-human.html

Purity

98.0

Smiles

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Molecular Formula

51327 (Gene_ID) Q9NZD4 (M1-S102) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Solute Carrier Family 26, Member 9 (SLC26A9) ELISA Kit
MBS9923734 Inquire

Duck Solute Carrier Family 26, Member 9 (SLC26A9) ELISA Kit

Sign In for Pricing
View Details
SLC35D1 Rabbit Polyclonal Antibody
orb3071855-01 30 µL

SLC35D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35D1 Rabbit Polyclonal Antibody
orb3071855-02 50 µL

SLC35D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35D1 Rabbit Polyclonal Antibody
orb3071855-03 100 µL

SLC35D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35D1 Rabbit Polyclonal Antibody
orb3071855-04 200 µL

SLC35D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tau protein antibody
orb1728048 1 mg

Tau protein antibody

Sign In for Pricing
View Details