Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 protein (CXCL8), partial (Active)

Product Specifications

Product Name Alternative

IL-8, Chemokine C-X-C motif, ligand 8, Emoctakin, Granulocyte chemotactic protein 1

Abbreviation

Recombinant Human CXCL8 protein, partial (Active)

Gene Name

CXCL8

UniProt

P10145

Expression Region

28-99aa

Organism

Homo sapiens (Human)

Target Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8 (6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8 (5-77) has increased activity on neutrophil activation and IL-8 (7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8 (1-77), respectively. {ECO:0000269|PubMed:11978786, ECO:0000269|PubMed:2145175, ECO:0000269|PubMed:2212672}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8 (6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8 (5-77) has increased activity on neutrophil activation and IL-8 (7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8 (1-77), respectively.

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDAH1 (NM_001134445) Human Over-expression Lysate
LC427443 20 µg

DDAH1 (NM_001134445) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL
BNC882103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD6/TP120 (Fc Tag)
PKSH030430 100 µg

Recombinant Human CD6/TP120 (Fc Tag)

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL
BNC041192-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sec61a2 Mouse Gene Knockout Kit (CRISPR)
KN515470 1 Kit

Sec61a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DTX2 (NM_001102596) Human Over-expression Lysate
LC420165 20 µg

DTX2 (NM_001102596) Human Over-expression Lysate

Sign In for Pricing
View Details