Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSHR, Human (His)

FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FSHR Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fshr-protein-human-his.html

Purity

95

Smiles

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Molecular Formula

2492 (Gene_ID) P23945-1 (C18-R366) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Complement Factor B Recombinant Protein C-6 His Tag
MBS8431650-01 0.05 mg

Human Complement Factor B Recombinant Protein C-6 His Tag

Ask
View Details
Human Complement Factor B Recombinant Protein C-6 His Tag
MBS8431650-02 5x 0.05 mg

Human Complement Factor B Recombinant Protein C-6 His Tag

Ask
View Details
FRMD5 (NM_032892) Human Tagged Lenti ORF Clone
RC208755L3 10 µg

FRMD5 (NM_032892) Human Tagged Lenti ORF Clone

Ask
View Details
Heatstable Enterotoxin 1 Antibody, AbBy Fluor™ 405 Conjugated
bs-8858R-BF405 100 µL

Heatstable Enterotoxin 1 Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody
TA373193 100 µL

ATP citrate lyase (ACLY) Rabbit Polyclonal Antibody

Ask
View Details
PH 7.01.00 Technical Buffer Sol
HI5007 1 Each

PH 7.01.00 Technical Buffer Sol

Ask
View Details