Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSHR, Human (His)

FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FSHR Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fshr-protein-human-his.html

Purity

95

Smiles

CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR

Molecular Formula

2492 (Gene_ID) P23945-1 (C18-R366) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit
CK-bio-13679-01 48 Tests

Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit

Ask
View Details
Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit
CK-bio-13679-02 96 Tests

Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit

Ask
View Details
Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit
CK-bio-13679-03 5x 96 Tests

Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit

Ask
View Details
Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit
CK-bio-13679-04 10x 96 Tests

Human Thromboxane A2 receptor ELISA Kit, TXA2R ELISA Kit

Ask
View Details
Methaqualone 6-sulfate
282077-01 1 mg

Methaqualone 6-sulfate

Ask
View Details
Methaqualone 6-sulfate
282077-02 2 mg

Methaqualone 6-sulfate

Ask
View Details