Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4C, Human (His-SUMO)

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal (beta1-3/4) GlcNAc (beta1-2) Man. CLEC4C Protein, Human (His-SUMO) is the recombinant human-derived CLEC4C protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

CLEC4C Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4c-protein-human-his-sumo.html

Purity

90.00

Smiles

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Molecular Formula

170482 (Gene_ID) Q8WTT0-1 (N45-I213) (Accession)

Molecular Weight

Approximately 36.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHFPL3 Human Gene Knockout Kit (CRISPR)
KN420013 1 Kit

LHFPL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAPNS1 Polyclonal Antibody
E-AB-13959-01 20 µL

CAPNS1 Polyclonal Antibody

Sign In for Pricing
View Details
CAPNS1 Polyclonal Antibody
E-AB-13959-02 60 µL

CAPNS1 Polyclonal Antibody

Sign In for Pricing
View Details
CAPNS1 Polyclonal Antibody
E-AB-13959-03 120 µL

CAPNS1 Polyclonal Antibody

Sign In for Pricing
View Details
CAPNS1 Polyclonal Antibody
E-AB-13959-04 200 µL

CAPNS1 Polyclonal Antibody

Sign In for Pricing
View Details
C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate
LC422064 20 µg

C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate

Sign In for Pricing
View Details