Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Marmoset (HEK293, His)

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Marmoset (HEK293, His), Marmoset, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-marmoset-hek293-his.html

Purity

97.00

Smiles

APVKPPQPGAEVSEVWAQEGAPAQLPCSPTIPLQDLSLLRRGGVTWQHQPDSGPPAPVPGHPPAPGPRAAAPSSSRPGPRRYTVLSVAPGGLRSGRLPLQPRVQLEERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRTLSCHLRLRVGQASMTASPAGSLRTSDWVILNCSFSRPDRPASVQWFRGGGQGRVPVQESPHHHLAESFLFLPQVSLMDSGPWGCTLTYRDGFSVSIVYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPPGVGTQPFLTAKWAPPGGGPDLLVPGDNGNFTLQLEDVSQAQAGTYTCHICLQGQQLSATVTLAVITVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDAPSQRSFPGPWLEAQDAQLLSQPWQCQLYQGERLLGAAVYFTALSSPGAQRSGRAPGALHAGH

Molecular Formula

100415501 (Gene_ID) XP_002752325.1 (A18-H449) (Accession)

Molecular Weight

Approximately 57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF680 conjugate, 0.1mg/mL
BNC800749-100 1x 100 µL

CD8 (C8/144B), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details