Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Marmoset (HEK293, His)

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Marmoset (HEK293, His), Marmoset, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-marmoset-hek293-his.html

Purity

97.00

Smiles

APVKPPQPGAEVSEVWAQEGAPAQLPCSPTIPLQDLSLLRRGGVTWQHQPDSGPPAPVPGHPPAPGPRAAAPSSSRPGPRRYTVLSVAPGGLRSGRLPLQPRVQLEERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRTLSCHLRLRVGQASMTASPAGSLRTSDWVILNCSFSRPDRPASVQWFRGGGQGRVPVQESPHHHLAESFLFLPQVSLMDSGPWGCTLTYRDGFSVSIVYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPPGVGTQPFLTAKWAPPGGGPDLLVPGDNGNFTLQLEDVSQAQAGTYTCHICLQGQQLSATVTLAVITVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDAPSQRSFPGPWLEAQDAQLLSQPWQCQLYQGERLLGAAVYFTALSSPGAQRSGRAPGALHAGH

Molecular Formula

100415501 (Gene_ID) XP_002752325.1 (A18-H449) (Accession)

Molecular Weight

Approximately 57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Rabbit Ig:DyLight 594 Secondary Antibody
MBS474562-01 0.5 mL

Anti-Rabbit Ig:DyLight 594 Secondary Antibody

Sign In for Pricing
View Details
Anti-Rabbit Ig:DyLight 594 Secondary Antibody
MBS474562-02 5x 0.5 mL

Anti-Rabbit Ig:DyLight 594 Secondary Antibody

Sign In for Pricing
View Details
Aminomalonic acid 50mg
A19289-50 50 mg

Aminomalonic acid 50mg

Sign In for Pricing
View Details
2-Hydroxy-1,2,3-propanetricarboxylic Acid 1-Butyl Ester
sc-488158 10 mg

2-Hydroxy-1,2,3-propanetricarboxylic Acid 1-Butyl Ester

Sign In for Pricing
View Details
Pbld1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3543507 1.0 µg DNA

Pbld1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Idh1 Pre-designed siRNA Set B
SI106490B 1 Each

Mouse Idh1 Pre-designed siRNA Set B

Sign In for Pricing
View Details