Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Calotropis procera Osmotin, partial

Product Specifications

Product Name Alternative

(CpOsm) (Fragment)

Abbreviation

Recombinant Calotropis procera Osmotin protein, partial

UniProt

P86363

Expression Region

1-40aa

Organism

Calotropis procera (Roostertree) (Asclepias procera)

Target Sequence

ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Has antifungal activity. Inhibits spore germination and mycelia growth in F.solani (IC (50) =67.0 ug/ml), C.gloeosporioides (IC (50) =32.1 ug/ml) and a Neurospora isolate (IC (50) =57.5 ug/ml) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.5 kDa

References & Citations

"Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense." Teixeira de Freitas C.D., Sousa Nogueira F.C., Vasconcelos I.M., Abreu Oliveira J.T., Domont G.B., Ramos M.V. Plant Physiol. Biochem. 49:738-743 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL
BNC882685-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details