Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Platelet-derived growth factor subunit B (PDGFB)

Product Specifications

Product Name Alternative

PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide

Abbreviation

Recombinant Sheep PDGFB protein

Gene Name

PDGFB

UniProt

Q95229

Expression Region

82-190aa

Organism

Ovis aries (Sheep)

Target Sequence

SLGSPTVAEPAVIAECKTRTEVSEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVMARAVTR

Tag

N-terminal 6xHis-TrxA-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK6 (NM_001145001) Human Over-expression Lysate
LC428635 20 µg

NEK6 (NM_001145001) Human Over-expression Lysate

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-14644-01 20 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-14644-02 60 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-14644-03 120 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-14644-04 200 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
EFS Rabbit Polyclonal Antibody
TA375739 100 µL

EFS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details