Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Membrane progestin receptor alpha (PAQR7)

Product Specifications

Product Name Alternative

MPR alpha ; Membrane progesterone P4 receptor alpha; Membrane progesterone receptor alpha ; Progesterone and adipoQ receptor family member 7; Progestin and adipoQ receptor family member 7; Progestin and adipoQ receptor family member VII

Abbreviation

Recombinant Human PAQR7 protein

Gene Name

PAQR7

UniProt

Q86WK9

Expression Region

1-346aa

Organism

Homo sapiens (Human)

Target Sequence

MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Signal Transduction

Relevance

Plasma membrane progesterone (P4) receptor coupled to G proteins . Seems to act through a G (i) mediated pathway) . May be involved in oocyte maturation. Involved in neurosteroid inhibition of apoptosis. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CD1 Placenta-E15 Total Protein
MT-413-15 0.5 mg

Mouse CD1 Placenta-E15 Total Protein

Ask
View Details
CXCL16 (C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-inducible Cytokine B16, Transmembrane Chemokine CXCL16, SRPSOX) (MaxLight 750)
MBS6232379-01 0.1 mL

CXCL16 (C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-inducible Cytokine B16, Transmembrane Chemokine CXCL16, SRPSOX) (MaxLight 750)

Ask
View Details
CXCL16 (C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-inducible Cytokine B16, Transmembrane Chemokine CXCL16, SRPSOX) (MaxLight 750)
MBS6232379-02 5x 0.1 mL

CXCL16 (C-X-C Motif Chemokine 16, Scavenger Receptor for Phosphatidylserine and Oxidized Low Density Lipoprotein, SR-PSOX, Small-inducible Cytokine B16, Transmembrane Chemokine CXCL16, SRPSOX) (MaxLight 750)

Ask
View Details
Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)
MBS1328839-01 0.02 mg (E-Coli)

Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)

Ask
View Details
Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)
MBS1328839-02 0.02 mg (Yeast)

Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)

Ask
View Details
Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)
MBS1328839-03 0.1 mg (E-Coli)

Recombinant Pasteurella multocida Bifunctional protein HldE (hldE)

Ask
View Details