Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RB, Mouse (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 269 amino acids (R18-G286) .

Product Specifications

Product Name Alternative

IL-17RB Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rb-protein-mouse-269a-a-hek293-his.html

Smiles

REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG

Molecular Formula

50905 (Gene_ID) Q9JIP3-1 (R18-G286) (Accession)

Molecular Weight

Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lei Ren, et al. IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression. Mol Immunol. 2017 Oct;90:126-135.|[2]Y Shi, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275 (25) :19167-76.|[3]Jérémy Bastid, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klra1 ORF Vector (Rat) (pORF)
ORF069147 1.0 µg DNA

Klra1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
SPTLC1 (NM_006415) Human Tagged Lenti ORF Clone
RC222985L1 10 µg

SPTLC1 (NM_006415) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM314) [DyLight 594]
NBP2-34408DL594 0.1 mL

Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (SPM314) [DyLight 594]

Sign In for Pricing
View Details
Anti-DCX antibody
STJ23349 100 µl

Anti-DCX antibody

Sign In for Pricing
View Details
TAF1C  Polyclonal Antibody
MBS2535347-01 0.06 mL

TAF1C Polyclonal Antibody

Sign In for Pricing
View Details
TAF1C  Polyclonal Antibody
MBS2535347-02 0.12 mL

TAF1C Polyclonal Antibody

Sign In for Pricing
View Details