Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RB, Mouse (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 269 amino acids (R18-G286) .

Product Specifications

Product Name Alternative

IL-17RB Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rb-protein-mouse-269a-a-hek293-his.html

Smiles

REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG

Molecular Formula

50905 (Gene_ID) Q9JIP3-1 (R18-G286) (Accession)

Molecular Weight

Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lei Ren, et al. IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression. Mol Immunol. 2017 Oct;90:126-135.|[2]Y Shi, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275 (25) :19167-76.|[3]Jérémy Bastid, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mrm1 Pre-designed siRNA Set A
SI108669A 1 Each

Mouse Mrm1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Anti-Rat Complement Component 3a (C3a) Polyclonal Antibody
VD3N389 1 Each

Rabbit Anti-Rat Complement Component 3a (C3a) Polyclonal Antibody

Sign In for Pricing
View Details
Electroporation Cuvettes 1mm Long
FBR-201 50 / PCK

Electroporation Cuvettes 1mm Long

Sign In for Pricing
View Details
Protein A Detection Kit
GWB-E6F1AA 1 Kit

Protein A Detection Kit

Sign In for Pricing
View Details
9-Chlorophenanthrene-13C6 (mixture of 2 isomers, Contain 4.2% unlabeled)
TRC-C374977-0.5MG 0.5 mg

9-Chlorophenanthrene-13C6 (mixture of 2 isomers, Contain 4.2% unlabeled)

Sign In for Pricing
View Details
CD69 Monoclonal Antibody
UB-GEN-13597 100 µL

CD69 Monoclonal Antibody

Sign In for Pricing
View Details