MIP-2/CXCL2, Mouse (His)
MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived MIP-2/CXCL2 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIP-2/CXCL2 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-2-cxcl2-protein-mouse-his.html
Smiles
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Molecular Formula
20310 (Gene_ID) P10889 (A28-N100) (Accession)
Molecular Weight
11.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53 (TRP53), Tumor Protein p53, Tumor Suppressor p53) (BSA & Azide Free) (MaxLight 550)
p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53 (TRP53), Tumor Protein p53, Tumor Suppressor p53) (BSA & Azide Free) (MaxLight 550)
