Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNMT, Human (His)

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GNMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gnmt-protein-human-his.html

Purity

98.0

Smiles

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Molecular Formula

27232 (Gene_ID) Q14749 (M1-D295) (Accession)

Molecular Weight

Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAM2 (NM_012288) Human Untagged Clone
SC115438 10 µg

TRAM2 (NM_012288) Human Untagged Clone

Sign In for Pricing
View Details
NR5A2
570563-01 50 µg

NR5A2

Sign In for Pricing
View Details
NR5A2
570563-02 100 µg

NR5A2

Sign In for Pricing
View Details
ISO20560PM-180X1700-ZWAVELZUUR Pipe Markers for Gases
317593 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-180X1700-ZWAVELZUUR Pipe Markers for Gases

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-40C, RAB40C ELISA Kit
MBS9317626-01 48 Well

Mouse Ras-related protein Rab-40C, RAB40C ELISA Kit

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-40C, RAB40C ELISA Kit
MBS9317626-02 96 Well

Mouse Ras-related protein Rab-40C, RAB40C ELISA Kit

Sign In for Pricing
View Details