Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNMT, Human (His)

Glycine N-methyltransferase (GNMT) is responsible for catalyzing the methylation of glycine, using S-adenosylmethionine (AdoMet) to generate N-methylglycine (sarcosine), and simultaneously producing S-adenosyl homocysteine AdoHcy. This reaction is complexly regulated by 5-methyltetrahydrofolate binding, highlighting the critical role of GNMT in the regulation of methyl metabolism. GNMT Protein, Human (His) is the recombinant human-derived GNMT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GNMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gnmt-protein-human-his.html

Purity

98.0

Smiles

MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Molecular Formula

27232 (Gene_ID) Q14749 (M1-D295) (Accession)

Molecular Weight

Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KRT86, ID (KRT86, KRTHB6, Keratin, type II cuticular Hb6, Hair keratin K2.11, Keratin-86, Type II hair keratin Hb6, Type-II keratin Kb26) (MaxLight 650)
MBS6314829-01 0.1 mL

KRT86, ID (KRT86, KRTHB6, Keratin, type II cuticular Hb6, Hair keratin K2.11, Keratin-86, Type II hair keratin Hb6, Type-II keratin Kb26) (MaxLight 650)

Ask
View Details
KRT86, ID (KRT86, KRTHB6, Keratin, type II cuticular Hb6, Hair keratin K2.11, Keratin-86, Type II hair keratin Hb6, Type-II keratin Kb26) (MaxLight 650)
MBS6314829-02 5x 0.1 mL

KRT86, ID (KRT86, KRTHB6, Keratin, type II cuticular Hb6, Hair keratin K2.11, Keratin-86, Type II hair keratin Hb6, Type-II keratin Kb26) (MaxLight 650)

Ask
View Details
Human CEP68 knockout cell line
ABC-KH2946 1 Vial

Human CEP68 knockout cell line

Ask
View Details
Human Lamin-B2, LMNB2 ELISA KIT
ELI-37439h 96 Tests

Human Lamin-B2, LMNB2 ELISA KIT

Ask
View Details
L-Aspartic acid β-hydroxaMate serine raceMase inhibitor
JH915877 1 Each

L-Aspartic acid β-hydroxaMate serine raceMase inhibitor

Ask
View Details