Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD105/Endoglin, Human (Trx-His)

CD105/Endoglin Protein, Human (Trx-His) is an accessory receptor for transforming growth factor beta (TGF-β), and is expressed on endothelial cells.

Product Specifications

Product Name Alternative

CD105/Endoglin Protein, Human (Trx-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd105-endoglin-protein-human-trx-his.html

Purity

96.32

Smiles

ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ

Molecular Formula

2022 (Gene_ID) AAH14271.1 (E26-Q176) (Accession)

Molecular Weight

Approximately 34 kDa

References & Citations

[1]Farshad Nassiri, et al. Endoglin (CD105) : a review of its role in angiogenesis and tumor diagnosis, progression and therapy. Anticancer Res. 2011 Jun;31 (6) :2283-90.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-SARS-CoV-2 S protein (9MW 3311) Biosimilar (Monoclonal, IgG)
A136642 100 µL

Anti-SARS-CoV-2 S protein (9MW 3311) Biosimilar (Monoclonal, IgG)

Ask
View Details
NME1 (Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, Tumor Metastatic Process-Associated Protein, Metastasis Inhibition Factor nm23, nm23-H1, Granzyme A-Activated DNase, GAAD, NDPKA, NM23) (Azide Free) (MaxLight 650)
MBS6220477-01 0.1 mL

NME1 (Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, Tumor Metastatic Process-Associated Protein, Metastasis Inhibition Factor nm23, nm23-H1, Granzyme A-Activated DNase, GAAD, NDPKA, NM23) (Azide Free) (MaxLight 650)

Ask
View Details
NME1 (Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, Tumor Metastatic Process-Associated Protein, Metastasis Inhibition Factor nm23, nm23-H1, Granzyme A-Activated DNase, GAAD, NDPKA, NM23) (Azide Free) (MaxLight 650)
MBS6220477-02 5x 0.1 mL

NME1 (Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, Tumor Metastatic Process-Associated Protein, Metastasis Inhibition Factor nm23, nm23-H1, Granzyme A-Activated DNase, GAAD, NDPKA, NM23) (Azide Free) (MaxLight 650)

Ask
View Details
LTB4 Parameter Assay Kit
KGE006B 96 Tests

LTB4 Parameter Assay Kit

Ask
View Details
Platelet Factor 4 (PF4) – human, recombinant
PF4-hr-02 200 µg

Platelet Factor 4 (PF4) – human, recombinant

Ask
View Details
Phorbol 12-myristate 13-acetate
GK8317-5mg 5 mg

Phorbol 12-myristate 13-acetate

Ask
View Details