Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2A1, Human (His)

The BCL2A1 protein plays a critical role in resisting apoptosis triggered by IL-3 deprivation, suggesting its importance in the response of hematopoietic cells to external signals and may be involved in protecting endothelial cell survival during infection. It also inhibits serum starvation-induced apoptosis in mammary epithelial cells (HC11) . BCL2A1 Protein, Human (His) is the recombinant human-derived BCL2A1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

BCL2A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl2a1-protein-human-his.html

Purity

98.0

Smiles

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS

Molecular Formula

597 (Gene_ID) Q16548 (M1-S152) (Accession)

Molecular Weight

Approximately 16-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-02 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-03 0.02 mg (Yeast)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-04 0.1 mg (Yeast)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-05 0.02 mg (Baculovirus)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)
MBS1166076-06 0.02 mg (Mammalian-Cell)

Recombinant Haemophilus influenzae UPF0149 protein HI_0817 (HI_0817)

Sign In for Pricing
View Details