Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPIHBP1, Human (HEK293, Fc)

The GPIHBP1 protein mediates lipid metabolism by transporting lipoprotein lipase LPL, anchoring it in capillaries, and preventing loss of activity. It has a crucial role in chylomicron lipolysis, triglyceride metabolism, and overall lipid homeostasis. GPIHBP1 Protein, Human (HEK293, Fc) is the recombinant human-derived GPIHBP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GPIHBP1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpihbp1-protein-human-hek-293-fc.html

Purity

98.0

Smiles

TQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG

Molecular Formula

338328 (Gene_ID) Q8IV16 (T22-G151) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL
BNC472478-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details