Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPIHBP1, Human (HEK293, Fc)

The GPIHBP1 protein mediates lipid metabolism by transporting lipoprotein lipase LPL, anchoring it in capillaries, and preventing loss of activity. It has a crucial role in chylomicron lipolysis, triglyceride metabolism, and overall lipid homeostasis. GPIHBP1 Protein, Human (HEK293, Fc) is the recombinant human-derived GPIHBP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GPIHBP1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpihbp1-protein-human-hek-293-fc.html

Purity

98.0

Smiles

TQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG

Molecular Formula

338328 (Gene_ID) Q8IV16 (T22-G151) (Accession)

Molecular Weight

50-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SLC39A14 siRNA
abx933975-01 15 nmol

Mouse SLC39A14 siRNA

Sign In for Pricing
View Details
Mouse SLC39A14 siRNA
abx933975-02 30 nmol

Mouse SLC39A14 siRNA

Sign In for Pricing
View Details
SH-PTP1 (PTY11)
sc-56964 100 µg/mL

SH-PTP1 (PTY11)

Sign In for Pricing
View Details
Suppressor of Tumorigenicity 20 protein (ST20) Human ELISA Kit
H3721 96 Tests

Suppressor of Tumorigenicity 20 protein (ST20) Human ELISA Kit

Sign In for Pricing
View Details
Methyl 3-amino-3- (2-fluorophenyl) butanoate
LKC04832-01 50 mg

Methyl 3-amino-3- (2-fluorophenyl) butanoate

Sign In for Pricing
View Details
Methyl 3-amino-3- (2-fluorophenyl) butanoate
LKC04832-02 0.5 g

Methyl 3-amino-3- (2-fluorophenyl) butanoate

Sign In for Pricing
View Details