Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spastin (SPAST), partial

Product Specifications

Product Name Alternative

Spastic paraplegia 4 protein

Abbreviation

Recombinant Human SPAST protein, partial

Gene Name

SPAST

UniProt

Q9UBP0

Expression Region

317-616aa

Organism

Homo sapiens (Human)

Target Sequence

FRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

ATP-dependent microtubule severing protein that specifically recognizes and cuts microtubules that are polyglutamylated. Preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold. Severing activity is not dependent on tubulin acetylation or detyrosination. Microtubule severing promotes reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. It is critical for the biogenesis and maintenance of complex microtubule arrays in axons, spindles and cilia. SPAST is involved in abscission step of cytokinesis and nuclear envelope reassembly during anaphase in cooperation with the ESCRT-III complex. Recruited at the midbody, probably by IST1, and participates in membrane fission during abscission together with the ESCRT-III complex. Recruited to the nuclear membrane by IST1 and mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and endosome recycling. Recruited by IST1 to endosomes and regulates early endosomal tubulation and recycling by mediating microtubule severing. Probably plays a role in axon growth and the formation of axonal branches. ; [Isoform 1]: Involved in lipid metabolism by regulating the size and distribution of lipid droplets.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vaccination ring
E3347 1 Unit

Vaccination ring

Sign In for Pricing
View Details
Anti-Peropsin (D237) RRH Antibody
A07038-1 100 µL

Anti-Peropsin (D237) RRH Antibody

Sign In for Pricing
View Details
Mouse CLDN22 shRNA Plasmid
abx978465-01 150 µg

Mouse CLDN22 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CLDN22 shRNA Plasmid
abx978465-02 300 µg

Mouse CLDN22 shRNA Plasmid

Sign In for Pricing
View Details
U-87 MG (Human Malignant Glioblastoma Cells)
C6981 1 PC/Bottle

U-87 MG (Human Malignant Glioblastoma Cells)

Sign In for Pricing
View Details
Lentiviral mouse Sqor shRNA (UAS) - Lentiviral mouseSqor shRNA (UAS, GFP) (25)
GTR15240044 1 Vial

Lentiviral mouse Sqor shRNA (UAS) - Lentiviral mouseSqor shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details