Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-11 (Il11), Biotinylated

Product Specifications

Product Name Alternative

IL-11

Abbreviation

Recombinant Mouse Il11 protein, Biotinylated

Gene Name

Il11

UniProt

P47873

Expression Region

22-199aa

Organism

Mus musculus (Mouse)

Target Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:8913282) . Also promotes the proliferation of hepatocytes in response to liver damage (PubMed:22253262) . Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers (PubMed:10026196, PubMed:23948300) . Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3 (PubMed:23948300, PubMed:22253262) . The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling' (By similarity)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

66.9 kDa

References & Citations

"Interleukin-11 is the dominant IL-6 family cytokine during gastrointestinal tumorigenesis and can be targeted therapeutically." Putoczki T.L., Thiem S., Loving A., Busuttil R.A., Wilson N.J., Ziegler P.K., Nguyen P.M., Preaudet A., Farid R., Edwards K.M., Boglev Y., Luwor R.B., Jarnicki A., Horst D., Boussioutas A., Heath J.K., Sieber O.M., Pleines I. Ernst M. Cancer Cell 24:257-271 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-01 0.02 mg (E-Coli)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details
Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-02 0.1 mg (E-Coli)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details
Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-03 0.02 mg (Yeast)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details
Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-04 0.1 mg (Yeast)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details
Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details
Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)
MBS1021328-06 0.02 mg (Mammalian-Cell)

Recombinant Mycobacterium gilvum Urease accessory protein UreG (ureG)

Ask
View Details