Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

Product Specifications

Product Name Alternative

Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA

Abbreviation

Recombinant Human LIF protein (Active)

Gene Name

LIF

UniProt

P15018

Expression Region

23-202aa

Organism

Homo sapiens (Human)

Target Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Human and murine mature LIF exhibit a 78% sequence identity at the amino acid level. Human LIF is equally active on human and mouse cells. Murine LIF is approximately 1000 fold less active on human cells than human LIF.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 25-150 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 0.02% Tween 20, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANP32B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0096208 1.0 µg DNA

ANP32B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Acetyl NF kB P65 (K314/K315) discontinued
532688-01 30ul

Acetyl NF kB P65 (K314/K315) discontinued

Sign In for Pricing
View Details
Acetyl NF kB P65 (K314/K315) discontinued
532688-02 100 µL

Acetyl NF kB P65 (K314/K315) discontinued

Sign In for Pricing
View Details
Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit
KTE60132-01 48 Tests

Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details
Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit
KTE60132-02 96 Tests

Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details
Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit
KTE60132-03 5x 96 Tests

Human Short transient receptor potential channel 6 (TRPC6) ELISA Kit

Sign In for Pricing
View Details