IL-2R gamma/CD132, Human (HEK293, His)

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA

[1]S Hodge, et al. Surface and intracellular interleukin-2 receptor expression on various resting and activated populations involved in cell-mediated immunity in human peripheral blood. Scand J Immunol. 2000 Jan;51 (1) :67-73.|[2]SHodge, etal.Surfaceandintracellularinterleukin-2receptorexpressiononvariousrestingandactivatedpopulationsinvolvedincell-mediatedimmunityinhumanperipheralblood.ScandJImmunol.2000Jan;51 (1) :67-72.|[3]W P Weidanz, et al. Signalling through the IL-2 receptor γ (c) peptide (CD133) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria.|[4]W P Weidanz, et al. Signalling through the IL-2 receptor γ (c) peptide (CD132) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria.|[5]M C Bosco, et al. The gamma subunit of the interleukin-2 receptor is expressed in human monocytes and modulated by interleukin-2, interferon gamma, and transforming growth factor beta 1. Blood. 1994 Jun 15;83 (12) :3462-8.|[6]M C Bosco, et al. The gamma subunit of the interleukin-2 receptor is expressed in human monocytes and modulated by interleukin-2, interferon gamma, and transforming growth factor beta 1. Blood. 1994 Jun 15;83 (12) :3462-7.|[7]K Sugamura, et al. The interleukin-2 receptor gamma chain: its role in the multiple cytokine receptor complexes and T cell development in XSCID. Annu Rev Immunol. 1996;14:179-206.|[8]K Sugamura, et al. The interleukin-2 receptor gamma chain: its role in the multiple cytokine receptor complexes and T cell development in XSCID. Annu Rev Immunol. 1996;14:179-205.|[9]K Stenroos, et al. Expression of the mouse interleukin-2 receptor gamma chain in insect cells using a baculovirus expression vector--comparison with the human common gamma chain. Scand J Immunol. 1997 Feb;45 (2) :140-5.|[10]K Stenroos, et al. Expression of the mouse interleukin-2 receptor gamma chain in insect cells using a baculovirus expression vector--comparison with the human common gamma chain. Scand J Immunol. 1997 Feb;45 (2) :140-4.|[11]Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus) . Fish Shellfish Immunol. 2022 Mar;122:426-437.|[12]Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus) . Fish Shellfish Immunol. 2022 Mar;122:426-436.