Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPP1, Human (His)

UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UPP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/upp1-protein-human-his.html

Purity

95

Smiles

MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

Molecular Formula

7378 (Gene_ID) Q86Y75 (M1-A173) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Quinoxalinecarboxylic Acid-d4 (Major)
TRC-Q765267-1MG 1 mg

2-Quinoxalinecarboxylic Acid-d4 (Major)

Sign In for Pricing
View Details
C5orf56 (NM_001013717) Human Recombinant Protein
TP761898 50 µg

C5orf56 (NM_001013717) Human Recombinant Protein

Sign In for Pricing
View Details
Human spindlin 1 (SPIN1) activation kit by CRISPRa
GA107494 1 Kit

Human spindlin 1 (SPIN1) activation kit by CRISPRa

Sign In for Pricing
View Details
DPP8 (C-term) Rabbit Polyclonal Antibody
AP17292PU-N 400 µL

DPP8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5, 5'-Difluoro BAPTA, tetrapotassium salt
#50006 1x 100 mg

5, 5'-Difluoro BAPTA, tetrapotassium salt

Sign In for Pricing
View Details
2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one
TRC-H951240-250MG 250 mg

2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one

Sign In for Pricing
View Details