Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPP1, Human (His)

UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UPP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/upp1-protein-human-his.html

Purity

95

Smiles

MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA

Molecular Formula

7378 (Gene_ID) Q86Y75 (M1-A173) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL46 Polyclonal Antibody, HRP Conjugated
A67695-050 50 µL

MRPL46 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
GH1 Protein Vector (Human) (pPM-C-HA)
21492021 500 ng

GH1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-PE CD261/TRAIL-R1 (Rabbit, Monoclonal)
A118599 100 µL

Anti-PE CD261/TRAIL-R1 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RGA2 Polyclonal Antibody
MBS9017429 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) RGA2 Polyclonal Antibody

Sign In for Pricing
View Details
Martinostat hydrochloride
orb3132268-01 1 mg

Martinostat hydrochloride

Sign In for Pricing
View Details
Martinostat hydrochloride
orb3132268-02 5 mg

Martinostat hydrochloride

Sign In for Pricing
View Details