Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Mouse (His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-mouse-his.html

Purity

98.0

Smiles

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Molecular Formula

17319 (Gene_ID) P34884 (P2-A115) (Accession)

Molecular Weight

Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Vanbaalenii hemH Protein (aa 1-339)
VAng-Yyj5210-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Vanbaalenii hemH Protein (aa 1-339)

Sign In for Pricing
View Details
STMN4, NT (STMN4, Stathmin-4, Stathmin-like protein B3) (APC)
MBS6352149-01 0.2 mL

STMN4, NT (STMN4, Stathmin-4, Stathmin-like protein B3) (APC)

Sign In for Pricing
View Details
STMN4, NT (STMN4, Stathmin-4, Stathmin-like protein B3) (APC)
MBS6352149-02 5x 0.2 mL

STMN4, NT (STMN4, Stathmin-4, Stathmin-like protein B3) (APC)

Sign In for Pricing
View Details
Mouse IFN-gamma Alexa Fluor 750 Antibody (Clone 37895R)
IC4851S-100UG 100 µg

Mouse IFN-gamma Alexa Fluor 750 Antibody (Clone 37895R)

Sign In for Pricing
View Details
ETV6 (14A18) Rabbit Monoclonal Antibody
E28M6553 100 µL

ETV6 (14A18) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human PCCB Knockout HEK293T cell line
GTR15408125 1 Vial

Human PCCB Knockout HEK293T cell line

Sign In for Pricing
View Details